Loading...
Statistics
Advertisement

Esselon Artisan Coffee Roasters Premium Coffee Beans & Teas
www.esselon.com/
Esselon artisan coffee roasters in Hadley, MA offers fresh roasted premium coffee beans and imported teas, for retail and wholesale. Award winning cafe too!

Esselon.com

Advertisement
Esselon.com is hosted in United States / Arlington Heights . Esselon.com doesn't use HTTPS protocol. Number of used technologies: 12. First technologies: CSS, Flexslider, Google Font API, Number of used javascripts: 10. First javascripts: Greensock.js, Jquery.js, Jquery-migrate.min.js, Number of used analytics tools: 1. First analytics tools: Google Analytics, Number of used plugins, modules: 5. Its server type is: Apache. Its CMS is: Wordpress.

Technologies in use by Esselon.com

Technology

Number of occurences: 12
  • CSS
  • Flexslider
  • Google Font API
  • Html
  • Html5
  • Javascript
  • jQuery
  • jQuery UI
  • Php
  • Pingback
  • Shortcodes
  • SVG

Advertisement

Javascripts

Number of occurences: 10
  • greensock.js
  • jquery.js
  • jquery-migrate.min.js
  • layerslider.kreaturamedia.jquery.js
  • layerslider.transitions.js
  • external-tracking.min.js
  • populate_products.js
  • comment-reply.min.js
  • main.min.js
  • wp-embed.min.js

Content Management System

Number of occurences: 1
  • Wordpress

Analytics

Number of occurences: 1
  • Google Analytics

Server Type

  • Apache

Social

Number of occurences: 1
  • Facebook Box

Used plugins, modules

Number of plugins and modules: 5
  • LayerSlider
  • google analyticator
  • shopsite plugin
  • cc child pages
  • visual form builder

Google Analytics ID

  • UA-6679183-1

Conversion rate optimization

visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Esselon.com

Missing HTTPS protocol.

    Meta - Esselon.com

    Number of occurences: 8
    • Name:
      Content: http://www.esselon.com/wp-content/uploads/2015/01/esselon-takeout-coffee.jpg
    • Name: viewport
      Content: width=device-width, initial-scale=1
    • Name: description
      Content: Esselon artisan coffee roasters in Hadley, MA offers fresh roasted premium coffee beans and imported teas, for retail and wholesale. Award winning cafe too!
    • Name: robots
      Content: noodp
    • Name: twitter:card
      Content: summary
    • Name: twitter:description
      Content: Esselon artisan coffee roasters in Hadley, MA offers fresh roasted premium coffee beans and imported teas, for retail and wholesale. Award winning cafe too!
    • Name: twitter:title
      Content: Esselon Artisan Coffee Roasters Premium Coffee Beans & Teas
    • Name: twitter:image
      Content: http://www.esselon.com/wp-content/uploads/2015/01/Esselon-Garden.jpg

    Server / Hosting

    • IP: 69.65.4.48
    • Latitude: 42.06
    • Longitude: -87.99
    • Country: United States
    • City: Arlington Heights

    Rname

    • ns.serverhost.net
    • ns2.serverhost.net
    • ns3.serverhost.net
    • mail.esselon.com

    Target

    • hostmaster.serverhost.net

    HTTP Header Response

    HTTP/1.1 200 OK Date: Mon, 05 Sep 2016 11:41:03 GMT Server: Apache X-Pingback: http://www.esselon.com/xmlrpc.php Link: ; rel="https://api.w.org/" Link: ; rel=shortlink Content-Type: text/html; charset=UTF-8 X-Cache: MISS from s_ub9 X-Cache-Lookup: MISS from s_ub9:80 Transfer-Encoding: chunked Via: 1.1 s_ub9 (squid/3.5.20) Connection: keep-alive

    DNS

    host: esselon.com
    1. class: IN
    2. ttl: 420
    3. type: A
    4. ip: 69.65.4.48
    host: esselon.com
    1. class: IN
    2. ttl: 420
    3. type: NS
    4. target: ns.serverhost.net
    host: esselon.com
    1. class: IN
    2. ttl: 420
    3. type: NS
    4. target: ns2.serverhost.net
    host: esselon.com
    1. class: IN
    2. ttl: 420
    3. type: NS
    4. target: ns3.serverhost.net
    host: esselon.com
    1. class: IN
    2. ttl: 420
    3. type: SOA
    4. mname: ns.serverhost.net
    5. rname: hostmaster.serverhost.net
    6. serial: 9100214
    7. refresh: 86400
    8. retry: 7200
    9. expire: 3600000
    10. minimum-ttl: 420
    host: esselon.com
    1. class: IN
    2. ttl: 420
    3. type: MX
    4. pri: 10
    5. target: mail.esselon.com

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.sselon.com, www.exsselon.com, www.xsselon.com, www.essselon.com, www.ssselon.com, www.ewsselon.com, www.wsselon.com, www.ersselon.com, www.rsselon.com, www.efsselon.com, www.fsselon.com, www.evsselon.com, www.vsselon.com, www.ecsselon.com, www.csselon.com, www.eqsselon.com, www.qsselon.com, www.easselon.com, www.asselon.com, www.eysselon.com, www.ysselon.com, www.eselon.com, www.eseselon.com, www.eeselon.com, www.eswselon.com, www.ewselon.com, www.esdselon.com, www.edselon.com, www.esxselon.com, www.exselon.com, www.esfselon.com, www.efselon.com, www.esgselon.com, www.egselon.com, www.estselon.com, www.etselon.com, www.eselon.com, www.esseelon.com, www.eseelon.com, www.esswelon.com, www.eswelon.com, www.essdelon.com, www.esdelon.com, www.essxelon.com, www.esxelon.com, www.essfelon.com, www.esfelon.com, www.essgelon.com, www.esgelon.com, www.esstelon.com, www.estelon.com, www.esslon.com, www.essxlon.com, www.esseslon.com, www.essslon.com, www.essewlon.com, www.esswlon.com, www.esserlon.com, www.essrlon.com, www.esseflon.com, www.essflon.com, www.essevlon.com, www.essvlon.com, www.esseclon.com, www.essclon.com, www.esseqlon.com, www.essqlon.com, www.essealon.com, www.essalon.com, www.esseylon.com, www.essylon.com, www.esseon.com, www.esseluon.com, www.esseuon.com, www.essel8on.com, www.esse8on.com, www.essel9on.com, www.esse9on.com, www.esseljon.com, www.essejon.com, www.essel0on.com, www.esse0on.com, www.esselmon.com, www.essemon.com, www.esselpon.com, www.essepon.com, www.esseloon.com, www.esseoon.com, www.esseln.com, www.esselobn.com, www.esselbn.com, www.esselohn.com, www.esselhn.com, www.esselogn.com, www.esselgn.com, www.esselojn.com, www.esseljn.com, www.esselomn.com, www.esselmn.com, www.esselo n.com, www.essel n.com, www.esselovn.com, www.esselvn.com, www.esselo.com, www.esselonn.com, www.esselon.com, www.esselonh.com, www.esseloh.com, www.esselonj.com, www.esseloj.com, www.esselonk.com, www.esselok.com, www.esselonl.com, www.esselol.com, www.esselon .com, www.esselo .com,

    Other websites we recently analyzed

    1. TT 2012 May 18th
      United Kingdom - 79.171.34.42
      Server software: Microsoft-IIS/6.0
      Technology: CSS, Html, Swf Object
      Number of meta tags: 1
    2. Forever Living Products Germany
      Germany - 62.146.64.106
      Server software: Apache
      Technology: CSS, Html, Html5, Javascript, jQuery UI, Lightbox, Php, SVG
      Number of Javascript: 15
      Number of meta tags: 7
    3. selfreliantlivingmarketplace.com
      Scottsdale (United States) - 184.168.221.96
      Server software: Microsoft-IIS/7.5
      Technology: Html, Html5, Iframe
    4. Agence web, création de sites internet à Paris
      Agence web à Paris Studio de conception et réalisation de sites internet, Paris Web Studio est une agence de communication digitale au service des entreprises
      France - 37.187.65.16
      Server software: Apache
      Technology: CSS, Font Awesome, Html, Html5, Javascript, jQuery, Php, Pingback, Revslider, Google Analytics, Wordpress
      Number of Javascript: 18
      Number of meta tags: 10
    5. MoDem78 | Mouvement Démocrate des Yvelines
      France - 213.186.33.82
      Server software: Apache
      Technology: CSS, Google Font API, Html, Html5, Iframe, Javascript, jQuery, Php, Pingback, Google Analytics, Wordpress, Facebook Box
      Number of Javascript: 9
      Number of meta tags: 3
    6. å¾·é›…
      Hangzhou (China) - 202.91.248.229
      Server software: IIS
      Technology: CSS, Html, Javascript
      Number of Javascript: 5
      Number of meta tags: 4
    7. www.giannitrapani.biz
      Arezzo (Italy) - 62.149.132.182
      Server software: Apache
      Technology: Html
      Number of meta tags: 1
    8. nefigasi.com
      Krasnodar (Russian Federation) - 212.192.128.21
      Server software: Apache/2.2.22 (Ubuntu)
      Technology: Html
      Number of meta tags: 1
    9. My Kinda Travel
      My Kinda Travel | Beach Breaks | Ski Deals | Lakes & Mountains Holidays
      United Kingdom - 62.73.160.215
      Server software: Apache
      Technology: CSS, Html, Javascript, Google Analytics
      Number of Javascript: 9
      Number of meta tags: 2
    10. 池田のりはる(池田徳晴)公式WEBサイト | 池田のりはる(池田徳晴)公式WEBサイト
      Japan - 203.189.105.206
      Server software: Apache
      Technology: CSS, Html, Html5, Iframe, jQuery, jQuery Cycle, Php, Pingback, Wordpress, Facebook Like box, Facebook Box
      Number of Javascript: 7
      Number of meta tags: 4

    Check Other Websites